General Information

  • ID:  hor005651
  • Uniprot ID:  Q9DG36
  • Protein name:  GnRH-associated peptide 2
  • Gene name:  gnrh2
  • Organism:  Lithobates catesbeianus (American bullfrog) (Rana catesbeiana)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  Expressed at significantly higher levels during hibernation and post-breeding. Not expressed in pituitary. |Midbrain and hindbrain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lithobates (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity
  • GO BP:  GO:0000003 reproduction; GO:0009755 hormone-mediated signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  ELDMPASPEVSEEIKLCEGEECAYLRNPRKNLLKNILGRSNQKKNADVLARQLQKK
  • Length:  56
  • Propeptide:  MACQRHLLFLLLVLFAVSTQLSHGQHWSHGWYPGGKRELDMPASPEVSEEIKLCEGEECAYLRNPRKNLLKNILGRSNQKKNADVLARQLQKK
  • Signal peptide:  MACQRHLLFLLLVLFAVSTQLSHG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9DG36-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005651_AF2.pdbhor005651_ESM.pdb

Physical Information

Mass: 739161 Formula: C274H465N83O87S3
Absent amino acids: FHTW Common amino acids: LEK
pI: 8.77 Basic residues: 11
Polar residues: 13 Hydrophobic residues: 16
Hydrophobicity: -93.21 Boman Index: -15249
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 87.14
Instability Index: 8184.29 Extinction Coefficient cystines: 1615
Absorbance 280nm: 29.36

Literature

  • PubMed ID:  11170016
  • Title:  Cloning and characterization of cDNAs encoding the GnRH1 and GnRH2 precursors from bullfrog (Rana catesbeiana)